General Information

  • ID:  hor005377
  • Uniprot ID:  P82373
  • Protein name:  Diuretic hormone class 1
  • Gene name:  NA
  • Organism:  Diploptera punctata (Pacific beetle cockroach)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Diploptera (genus), Diplopterinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TGTGPSLSIVNPLDVLRQRLLLEIARRRMRQTQNMIQANRDFLESI
  • Length:  46
  • Propeptide:  TGTGPSLSIVNPLDVLRQRLLLEIARRRMRQTQNMIQANRDFLESI
  • Signal peptide:  NA
  • Modification:  T46 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a greater effect on the transport of Na+?then K+?ions. In vitro, has synergistic effects with the smaller diuretic hormone DH(31) which co-occurs with it.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: 10(-8)~ 10(-9) M
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82373-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P82373-F1.pdbhor005377_AF2.pdbhor005377_ESM.pdb

Physical Information

Mass: 612504 Formula: C228H392N74O68S2
Absent amino acids: CHKWY Common amino acids: LR
pI: 12.1 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 16
Hydrophobicity: -33.26 Boman Index: -12011
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 110.22
Instability Index: 4688.26 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10841553
  • Title:  Cockroach diuretic hormones: characterization of a calcitonin-like peptide in insects.s